PDB entry 4j5u

View 4j5u on RCSB PDB site
Description: X-ray crystal structure of a serine hydroxymethyltransferase with covalently bound PLP from Rickettsia rickettsii str. Sheila Smith
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, transferase
Deposited on 2013-02-10, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Rickettsia rickettsii [TaxId:392021]
    Gene: glyA, A1G_06305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j5ua_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Rickettsia rickettsii [TaxId:392021]
    Gene: glyA, A1G_06305
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j5ub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j5uA (A:)
    mnifnnnlhetdkeineiikheklrqssvieliasenfvspavleaqgalltnkyaegyp
    skrfyngceevdkaenlaiervkklfnckyanvqphsgsqanqavylallqpgdtvlgms
    ldsgghlthgaapnmsgkwfnavsysvnketylidydeierladlhkpklliagfsaypr
    nidfakfreivdkvgayfmadiahiaglvatgehqspipyahavtstthktlrgprggli
    lsndeeighkinsalfpglqggplmhiiaakavaflenlqpeyksyiqqvisnakalass
    lqergydiltggtdnhivlvdlrkdgitgklaansldragitcnknaipfdetspfitsg
    irlgtpacttrgfkekdfvlvghmvadildglknnednsaleqqvlnevtklielfpfyg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j5uB (B:)
    mnifnnnlhetdkeineiikheklrqssvieliasenfvspavleaqgalltnkyaegyp
    skrfyngceevdkaenlaiervkklfnckyanvqphsgsqanqavylallqpgdtvlgms
    ldsgghlthgaapnmsgkwfnavsysvnketylidydeierladlhkpklliagfsaypr
    nidfakfreivdkvgayfmadiahiaglvatgehqspipyahavtstthktlrgprggli
    lsndeeighkinsalfpglqggplmhiiaakavaflenlqpeyksyiqqvisnakalass
    lqergydiltggtdnhivlvdlrkdgitgklaansldragitcnknaipfdetspfitsg
    irlgtpacttrgfkekdfvlvghmvadildglknnednsaleqqvlnevtklielfpfyg