PDB entry 4j5m

View 4j5m on RCSB PDB site
Description: Structure of the Cargo Binding Domain from Human Myosin Vb
Class: protein transport
Keywords: intracellular traffic, organelles, vesicles, human myosin Vb, PROTEIN TRANSPORT
Deposited on 2013-02-08, released 2013-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.192
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Unconventional myosin-Vb
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA1119, MYO5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4j5ma_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j5mA (A:)
    lnrqvtvqrkekdfqgmleyhkedeallirnlvtdlkpqmlsgtvpclpayilymcirha
    dytnddlkvhslltstingikkvlkkhnddfemtsfwlsntcrllhclkqysgdegfmtq
    ntakqnehclknfdlteyrqvlsdlsiqiyqqlikiaegvlqpmivsamlenesiqglsg
    vkptgyrkrsssmadgdnsycleaiirqmnafhtvmcdqgldpeiilqvfkqlfyminav
    tlnnlllrkdvcswstgmqlrynisqleewlrgrnlhqsgavqtmepliqaaqllqlkkk
    tqedaeaicslctslstqqivkilnlytplnefeervtvafirtiqaqlqerndpqqlll
    dakhmfpvlfpfnpssltmdsihipaclnleflnev
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5mA (A:)
    vqrkekdfqgmleyhkedeallirnlvtdlkpqmlsgtvpclpayilymcirhadytndd
    lkvhslltstingikkvlkkhnddfemtsfwlsntcrllhclkqysgdegfmtqntakqn
    ehclknfdlteyrqvlsdlsiqiyqqlikiaegvlqpmivsamlesycleaiirqmnafh
    tvmcdqgldpeiilqvfkqlfyminavtlnnlllrkdvcswstgmqlrynisqleewlrg
    rnlhqsgavqtmepliqaaqllqlkkktqedaeaicslctslstqqivkilnlytplnef
    eervtvafirtiqaqlqerndpqqllldakhmfpvlfpfnpssltmdsihipaclnlefl
    nev