PDB entry 4j5k

View 4j5k on RCSB PDB site
Description: Crystal structure analysis of Streptomyces aureofaciens ribonuclease Sa Y51F mutant
Class: hydrolase
Keywords: hydrolase, endoribonuclease, mutant
Deposited on 2013-02-08, released 2014-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.106
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: rnaSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered mutation (50)
    Domains in SCOPe 2.07: d4j5ka_
  • Chain 'B':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: rnaSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered mutation (50)
    Domains in SCOPe 2.07: d4j5kb_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j5kA (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygfyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j5kB (B:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygfyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc