PDB entry 4j5g
View 4j5g on RCSB PDB site
Description: Crystal structure analysis of Streptomyces aureofaciens ribonuclease Sa T95A mutant
Class: hydrolase
Keywords: hydrolase, endoribonuclease, mutant
Deposited on
2013-02-08, released
2014-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-11-15, with a file datestamp of
2017-11-10.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.58
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: guanyl-specific ribonuclease sa
Species: Streptomyces aureofaciens [TaxId:1894]
Gene: rnaSA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4j5ga_ - Chain 'B':
Compound: guanyl-specific ribonuclease sa
Species: Streptomyces aureofaciens [TaxId:1894]
Gene: rnaSA
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4j5gb_ - Heterogens: SO4, GOL, CAC, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4j5gA (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqac
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4j5gB (B:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqac