PDB entry 4j5g

View 4j5g on RCSB PDB site
Description: Crystal structure analysis of Streptomyces aureofaciens ribonuclease Sa T95A mutant
Class: hydrolase
Keywords: hydrolase, endoribonuclease, mutant
Deposited on 2013-02-08, released 2014-05-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: rnaSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d4j5ga_
  • Chain 'B':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: rnaSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d4j5gb_
  • Heterogens: SO4, GOL, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j5gA (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqac

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j5gB (B:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqac