PDB entry 4j4f

View 4j4f on RCSB PDB site
Description: Structure of P51G Cyanovirin-N swapped tetramer in the P212121 space group
Class: sugar binding protein
Keywords: CVNH fold, carbohydrate binding protein, antiviral protein, SUGAR BINDING PROTEIN
Deposited on 2013-02-06, released 2013-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.239
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered mutation (50)
    Domains in SCOPe 2.08: d4j4fa_
  • Chain 'B':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered mutation (50)
    Domains in SCOPe 2.08: d4j4fb_
  • Chain 'C':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered mutation (50)
    Domains in SCOPe 2.08: d4j4fc_
  • Chain 'D':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered mutation (50)
    Domains in SCOPe 2.08: d4j4fd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j4fA (A:)
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j4fB (B:)
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j4fC (C:)
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j4fD (D:)
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye