PDB entry 4j3e

View 4j3e on RCSB PDB site
Description: The 1.9A crystal structure of humanized Xenopus Mdm2 with nutlin-3a
Class: ligase/antagonist
Keywords: Mdm2, protein-protein interaction, imidazoline, ligase-antagonist complex, E3 ubiquitin ligase, p53, nucleus
Deposited on 2013-02-05, released 2013-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.196
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Xenopus laevis [TaxId:8355]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56273 (1-85)
      • initiating methionine (0)
      • engineered mutation (30)
      • engineered mutation (72)
      • engineered mutation (75)
    Domains in SCOPe 2.08: d4j3ea_
  • Heterogens: NUT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j3eA (A:)
meklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplg
elfgvqefsvkehrriyamisrnlvs