PDB entry 4j2y

View 4j2y on RCSB PDB site
Description: Crystal structure of a plant trypsin inhibitor EcTI in complex with bovine trypsin.
Class: hydrolase/hydrolase inhibitor
Keywords: trefoil, serine protease inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-02-05, released 2013-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin inhibitor
    Species: Enterolobium contortisiliquum [TaxId:55671]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P86451 (0-End)
      • conflict (48)
      • conflict (80)
      • conflict (87)
      • conflict (94-96)
      • conflict (98-99)
      • expression tag (101)
      • conflict (105)
      • expression tag (109)
      • conflict (113-114)
      • conflict (117-118)
      • conflict (120)
      • conflict (129)
      • conflict (155)
    Domains in SCOPe 2.06: d4j2ya_
  • Chain 'B':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j2yb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j2yA (A:)
    kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
    tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk
    ikpyrddyklvycegnsdddsckdlgisiddennrllvvkdgdplavrfvkahrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j2yA (A:)
    kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
    tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkehlfgsfkikp
    yrddyklvycesckdlgisiddennrllvvkdgdplavrfvkahr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j2yB (B:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn