PDB entry 4j2v

View 4j2v on RCSB PDB site
Description: Crystal Structure of Equine Serum Albumin in complex with 3,5-diiodosalicylic acid
Class: transport protein
Keywords: Equine serum albumin, transport protein, Helical, Serum Albumin Superfamily, Transport, Fatty acids, metabolites and drugs, Plasma
Deposited on 2013-02-05, released 2013-07-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.183
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j2va1, d4j2va2, d4j2va3
  • Heterogens: DIU, MLI, FMT, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j2vA (A:)
    dthkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesae
    ncdkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepd
    aqcaafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipk
    ldalkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkv
    hkecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsd
    lpalaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekcc
    aeadppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstp
    tlveigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdsl
    aerrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatk
    eqlktvlgnfsafvakccgredkeacfaeegpklvassqlala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j2vA (A:)
    hkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaenc
    dkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaq
    caafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipkld
    alkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhk
    ecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlp
    alaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccae
    adppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptl
    veigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslae
    rrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeq
    lktvlgnfsafvakccgredkeacfaeegpklvassqlala