PDB entry 4j2k

View 4j2k on RCSB PDB site
Description: Crystal structure of a plant trypsin inhibitor EcTI
Class: hydrolase inhibitor
Keywords: trefoil, Serine protease inhibitor, HYDROLASE INHIBITOR
Deposited on 2013-02-04, released 2013-05-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.184
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin inhibitor
    Species: Enterolobium contortisiliquum [TaxId:55671]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P86451 (0-End)
      • conflict (48)
      • conflict (80)
      • conflict (87)
      • conflict (94-96)
      • conflict (98-99)
      • expression tag (101)
      • conflict (105)
      • expression tag (109)
      • conflict (112-114)
      • conflict (117-118)
      • conflict (120)
      • conflict (129)
      • conflict (155)
    Domains in SCOPe 2.02: d4j2ka_
  • Chain 'B':
    Compound: trypsin inhibitor
    Species: Enterolobium contortisiliquum [TaxId:55671]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P86451 (0-End)
      • conflict (48)
      • conflict (80)
      • conflict (87)
      • conflict (94-96)
      • conflict (98-99)
      • expression tag (101)
      • conflict (105)
      • expression tag (109)
      • conflict (112-114)
      • conflict (117-118)
      • conflict (120)
      • conflict (129)
      • conflict (155)
  • Heterogens: IMD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4j2kA (A:)
kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk
ikpyrddyklvycegnsdddsckdlgisiddennrllvvkdgdplavrfvkahrrg

    Sequence, based on observed residues (ATOM records): (download) 
    >4j2kA (A:)
kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk
ikpyrddyklvycesckdlgisiddennrllvvkdgdplavrfvkahr

  • Chain 'B':
    No sequence available.