PDB entry 4j2k
View 4j2k on RCSB PDB site
Description: Crystal structure of a plant trypsin inhibitor EcTI
Class: hydrolase inhibitor
Keywords: trefoil, Serine protease inhibitor, HYDROLASE INHIBITOR
Deposited on
2013-02-04, released
2013-05-08
The last revision prior to the SCOPe 2.02 freeze date was dated
2013-05-08, with a file datestamp of
2013-05-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.184
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: trypsin inhibitor
Species: Enterolobium contortisiliquum [TaxId:55671]
Database cross-references and differences (RAF-indexed):
- Uniprot P86451 (0-End)
- conflict (48)
- conflict (80)
- conflict (87)
- conflict (94-96)
- conflict (98-99)
- expression tag (101)
- conflict (105)
- expression tag (109)
- conflict (112-114)
- conflict (117-118)
- conflict (120)
- conflict (129)
- conflict (155)
Domains in SCOPe 2.02: d4j2ka_ - Chain 'B':
Compound: trypsin inhibitor
Species: Enterolobium contortisiliquum [TaxId:55671]
Database cross-references and differences (RAF-indexed):
- Uniprot P86451 (0-End)
- conflict (48)
- conflict (80)
- conflict (87)
- conflict (94-96)
- conflict (98-99)
- expression tag (101)
- conflict (105)
- expression tag (109)
- conflict (112-114)
- conflict (117-118)
- conflict (120)
- conflict (129)
- conflict (155)
- Heterogens: IMD, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4j2kA (A:)
kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk
ikpyrddyklvycegnsdddsckdlgisiddennrllvvkdgdplavrfvkahrrg
Sequence, based on observed residues (ATOM records): (download)
>4j2kA (A:)
kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk
ikpyrddyklvycesckdlgisiddennrllvvkdgdplavrfvkahr
- Chain 'B':
No sequence available.