PDB entry 4j1x

View 4j1x on RCSB PDB site
Description: Crystal Structure of Fe(II)-HppE with alternative substrate (S)-1-HPP
Class: Metal Binding Protein
Keywords: keto product, Hydroxypropylphosphonic acid epoxidase, mononuclear non-heme iron enzyme, metal binding protein, cupin fold, phosphono migration
Deposited on 2013-02-03, released 2013-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.251
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j1xa1, d4j1xa2
  • Chain 'B':
    Compound: epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j1xb1, d4j1xb2
  • Chain 'C':
    Compound: epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j1xc1, d4j1xc2
  • Heterogens: FE2, 1JJ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j1xA (A:)
    sntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriah
    vlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplv
    vdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvpha
    ftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j1xA (A:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvl
    tdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaa
    kgtgsakliavnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j1xB (B:)
    sntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriah
    vlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplv
    vdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvpha
    ftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j1xB (B:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvl
    tdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaa
    kgtgsakliavnf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4j1xC (C:)
    sntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriah
    vlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplv
    vdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvpha
    ftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j1xC (C:)
    tktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvl
    gtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvd
    vltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaft
    aakgtgsakliavnf