PDB entry 4j1p

View 4j1p on RCSB PDB site
Description: X-ray crystal structure of bromodomain 2 of human brd2 in complex with rvx208 to 1.08 A resolution
Class: signaling protein/inhibitor
Keywords: brd2, bromodomain, signaling protein-inhibitor complex
Deposited on 2013-02-01, released 2014-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.13
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain containing 2, isoform CRA_a
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD2, DKFZp313H139, hCG_17503
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q658Y7 (2-113)
    • expression tag (0-1)
  Domains in SCOPe 2.05: d4j1pa_
• Heterogens: 1K0, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4j1pA (A:)
  smgklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkr
  kmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd