PDB entry 4j19

View 4j19 on RCSB PDB site
Description: Structure of a novel telomere repeat binding protein bound to DNA
Class: Transcription/DNA
Keywords: telomere repeat binding, telomeric DNA, Transcription-DNA complex
Deposited on 2013-02-01, released 2013-05-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.174
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMBOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j19a_
  • Chain 'B':
    Compound: Homeobox-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMBOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j19b_
  • Chain 'C':
    Compound: DNA (5'-d(*cp*tp*gp*tp*tp*ap*gp*gp*gp*tp*tp*ap*gp*gp*gp*tp*tp*ap*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*cp*tp*ap*ap*cp*cp*cp*tp*ap*ap*cp*cp*cp*tp*ap*ap*cp*a)-3')
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4j19A (A:)
gatlsmrpapipiedpewrqtpppvsatsgtfrlrrgsrftwrkeclavmesyfnenqyp
deakreeianacnaviqkpgkklsdlervtslkvynwfanrrkeikrraniea

    Sequence, based on observed residues (ATOM records): (download) 
    >4j19A (A:)
gsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdlervtslkvyn
wfanrrkeikrraniea

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4j19B (B:)
gatlsmrpapipiedpewrqtpppvsatsgtfrlrrgsrftwrkeclavmesyfnenqyp
deakreeianacnaviqkpgkklsdlervtslkvynwfanrrkeikrraniea

    Sequence, based on observed residues (ATOM records): (download) 
    >4j19B (B:)
rrgsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdlervtslkv
ynwfanrrkeikrran

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.