PDB entry 4j15

View 4j15 on RCSB PDB site
Description: Crystal structure of human cytosolic aspartyl-tRNA synthetase, a component of multi-tRNA synthetase complex
Class: ligase
Keywords: aspartyl-tRNA synthetase, tRNA, LIGASE
Deposited on 2013-02-01, released 2013-05-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate--tRNA ligase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: DARS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4j15a1, d4j15a2
  • Chain 'B':
    Compound: Aspartate--tRNA ligase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: DARS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4j15b1, d4j15b2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j15A (A:)
    mgsshhhhhhssglvprgshmpsasasrksqekpreimdaaedyakerygissmiqsqek
    pdrvlvrvrdltiqkadevvwvrarvhtsrakgkqcflvlrqqqfnvqalvavgdhaskq
    mvkfaaninkesivdvegvvrkvnqkigsctqqdvelhvqkiyvislaeprlplqlddav
    rpeaegeeegratvnqdtrldnrvidlrtstsqavfrlqsgichlfretlinkgfveiqt
    pkiisaasegganvftvsyfknnaylaqspqlykqmcicadfekvfsigpvfraedsnth
    rhltefvgldiemafnyhyhevmeeiadtmvqifkglqerfqteiqtvnkqfpcepfkfl
    eptlrleycealamlreagvemgdeddlstpnekllghlvkekydtdfyildkyplavrp
    fytmpdprnpkqsnsydmfmrgeeilsgaqrihdpqllteralhhgidlekikayidsfr
    fgapphagggiglervtmlflglhnvrqtsmfprdpkrltp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j15A (A:)
    aedyakerygissmiqsqekpdrvlvrvrdltiqkadevvwvrarvhtsrakgkqcflvl
    rqqqfnvqalvavgdhaskqmvkfaaninkesivdvegvvrkvnqkigsctqqdvelhvq
    kiyvislaeprlplqlddavrptvnqdtrldnrvidlrtstsqavfrlqsgichlfretl
    inkgfveiqtpkiqspqlykqmcicadfekvfsigpvfltefvgldiemafnyhyhevme
    eiadtmvqifkglqerfqteiqtvnkqfpcepfkfleptlrleycealamlreagvemgd
    eddlstpnekllghlvkekydtdfyildkyplavrpfytmpdprnpkqsnsydmfmrgee
    ilsgaqrihdpqllteralhhgidlekikayidsfrfgapphagggiglervtmlflglh
    nvrqtsmfprd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j15B (B:)
    mgsshhhhhhssglvprgshmpsasasrksqekpreimdaaedyakerygissmiqsqek
    pdrvlvrvrdltiqkadevvwvrarvhtsrakgkqcflvlrqqqfnvqalvavgdhaskq
    mvkfaaninkesivdvegvvrkvnqkigsctqqdvelhvqkiyvislaeprlplqlddav
    rpeaegeeegratvnqdtrldnrvidlrtstsqavfrlqsgichlfretlinkgfveiqt
    pkiisaasegganvftvsyfknnaylaqspqlykqmcicadfekvfsigpvfraedsnth
    rhltefvgldiemafnyhyhevmeeiadtmvqifkglqerfqteiqtvnkqfpcepfkfl
    eptlrleycealamlreagvemgdeddlstpnekllghlvkekydtdfyildkyplavrp
    fytmpdprnpkqsnsydmfmrgeeilsgaqrihdpqllteralhhgidlekikayidsfr
    fgapphagggiglervtmlflglhnvrqtsmfprdpkrltp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j15B (B:)
    aedyakerygissmiqsqekpdrvlvrvrdltiqkadevvwvrarvhtsrakgkqcflvl
    rqqqfnvqalvavgdhaskqmvkfaaninkesivdvegvvrkvnqkigsctqqdvelhvq
    kiyvislaeprlplqlddavrptvnqdtrldnrvidlrtstsqavfrlqsgichlfretl
    inkgfveiqtpkispqlykqmcicadfekvfsigpvfltefvgldiemafnyhyhevmee
    iadtmvqifkglqerfqteiqtvnkqfpcepfkfleptlrleycealamlreagvemgde
    ddlstpnekllghlvkekydtdfyildkyplavrpfytmpdprnpkqsnsydmfmrgeei
    lsgaqrihdpqllteralhhgidlekikayidsfrfgapphagggiglervtmlflglhn
    vrqtsmfprd