PDB entry 4iza

View 4iza on RCSB PDB site
Description: Structure of Dually Phosphorylated ERK2 bound to the PEA-15 Death Effector Domain
Class: Transferase
Keywords: MAP kinase, Death effector domain, Transferase
Deposited on 2013-01-29, released 2013-04-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK1, ERK2, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4izaa_
  • Chain 'B':
    Compound: Astrocytic phosphoprotein PEA-15
    Species: Homo sapiens [TaxId:9606]
    Gene: PEA15
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15121 (1-End)
      • expression tag (0)
  • Chain 'C':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK1, ERK2, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4izac_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4izaA (A:)
    gpggagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqty
    cqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsnd
    hicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfl
    teyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgil
    gspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkriev
    eqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4izaA (A:)
    pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
    eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
    yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
    rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
    dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
    pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgy
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4izaC (C:)
    gpggagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqty
    cqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsnd
    hicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfl
    teyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgil
    gspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkriev
    eqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4izaC (C:)
    pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
    eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
    yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadptrwyrapeimlnsk
    gytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinlkarny
    llslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyydpsdep
    iaeapfkfdmelddlpkeklkelifeetarfqpgy