PDB entry 4iym

View 4iym on RCSB PDB site
Description: Crystal structure of putative methylmalonate-semialdehyde dehydrogenase from Sinorhizobium meliloti 1021 complexed with NAD, target 011934
Class: oxidoreductase
Keywords: structural genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, OXIDOREDUCTASE
Deposited on 2013-01-28, released 2013-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.167
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iyma_
  • Chain 'B':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymb_
  • Chain 'C':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92RW4 (23-End)
      • expression tag (20-22)
    Domains in SCOPe 2.07: d4iymc1, d4iymc2
  • Chain 'D':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymd_
  • Chain 'E':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92RW4 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.07: d4iyme1, d4iyme2
  • Chain 'F':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymf_
  • Chain 'G':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymg_
  • Chain 'H':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymh_
  • Chain 'I':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymi_
  • Chain 'J':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymj_
  • Chain 'K':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymk_
  • Chain 'L':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iyml_
  • Chain 'M':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymm_
  • Chain 'N':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymn_
  • Chain 'O':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92RW4 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.07: d4iymo1, d4iymo2
  • Chain 'P':
    Compound: Methylmalonate-semialdehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: iolA, mmsA, R00726, SMc00781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iymp_
  • Heterogens: NAD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iymA (A:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymA (A:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iymB (B:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymB (B:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iymC (C:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymC (C:)
    qsmmyelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkw
    aatnpqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiph
    lqkseftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpser
    dpsvpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygta
    amngkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanr
    lidklvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklq
    gyenghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiyt
    rdgdaardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtkt
    itsrwpsgikd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4iymD (D:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymD (D:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4iymE (E:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymE (E:)
    mmyelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaa
    tnpqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlq
    kseftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdp
    svpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaam
    ngkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrli
    dklvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgy
    enghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrd
    gdaardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktit
    srwpsgikdg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4iymF (F:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymF (F:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4iymG (G:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymG (G:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4iymH (H:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymH (H:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikdg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4iymI (I:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymI (I:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikdg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4iymJ (J:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymJ (J:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikd
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4iymK (K:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymK (K:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4iymL (L:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymL (L:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikdg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4iymM (M:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymM (M:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikdg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4iymN (N:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymN (N:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikd
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4iymO (O:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymO (O:)
    mmyelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaa
    tnpqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlq
    kseftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdp
    svpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaam
    ngkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrli
    dklvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgy
    enghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrd
    gdaardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktit
    srwpsgikd
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4iymP (P:)
    mhhhhhhssgvdlgtenlyfqsmmyelghfidgkrvagtsgrvsnifnpatgevqgtval
    asdadlaaavesakaaqpkwaatnpqrrarvfmkfvqllndnmnelaemlsrehgktidd
    akgdivrglevcefvigiphlqkseftegagpgidmysirqpvgigagitpfnfpgmipm
    wmfapaiacgnafilkpserdpsvpirlaelmieaglpagilnvvngdkgavdailthpd
    iaavsfvgstpiaryvygtaamngkraqcfggaknhmiimpdadldqaanaligagygsa
    gercmaisvavpvgeetanrlidklvpmveslrigpytdekadmgpvvtkeaeqrirsli
    dsgieqgaklvvdgrdfklqgyenghfiggclfddvtpdmdiykteifgpvlsvvrarny
    eealslpmkheygngvaiytrdgdaardfasrinigmvgvnvpipvplayhsfggwksss
    fgdlnqhgtdsikfwtrtktitsrwpsgikdgaefsiptmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iymP (P:)
    myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
    npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
    seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
    vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
    gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
    klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
    nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
    daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
    rwpsgikdg