PDB entry 4ixz

View 4ixz on RCSB PDB site
Description: Native structure of cystathionine gamma lyase (XometC) from xanthomonas oryzae pv. oryzae at pH 9.0
Class: lyase
Keywords: PLP DEPENDENT ENZYME, LYASE, XOCGL, NATIVE, Cys-Met metabolism PLP dependent enzyme, cystathionine gamma lyase, PLP Binding
Deposited on 2013-01-28, released 2014-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: metB, XOCGL, XOO0778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ixza_
  • Chain 'B':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: metB, XOCGL, XOO0778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ixzb_
  • Chain 'C':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: metB, XOCGL, XOO0778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ixzc_
  • Chain 'D':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: metB, XOCGL, XOO0778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ixzd_
  • Heterogens: BCT, BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ixzA (A:)
    msnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysr
    thnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfe
    rvrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhgl
    ltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqn
    siggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashpqhv
    lakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipv
    arreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ixzA (A:)
    alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
    aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
    vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
    qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
    alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
    sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv
    rlsvgiedlgdlrgdleralv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ixzB (B:)
    msnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysr
    thnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfe
    rvrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhgl
    ltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqn
    siggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashpqhv
    lakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipv
    arreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ixzB (B:)
    alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
    aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
    vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
    qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
    alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
    sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv
    rlsvgiedlgdlrgdleralv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ixzC (C:)
    msnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysr
    thnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfe
    rvrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhgl
    ltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqn
    siggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashpqhv
    lakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipv
    arreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ixzC (C:)
    alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
    aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
    vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
    qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
    alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
    sivlkggfdaakrfcektelftlaeslggveslvnhpavmthpvarreqlgisdalvrls
    vgiedlgdlrgdleralv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ixzD (D:)
    msnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysr
    thnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfe
    rvrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhgl
    ltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqn
    siggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashpqhv
    lakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipv
    arreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ixzD (D:)
    alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
    aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
    vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
    qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
    alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
    sivlkggfdaakrfcektelftlaeslggveslvnhpavmthapvarreqlgisdalvrl
    svgiedlgdlrgdleral