PDB entry 4ixu

View 4ixu on RCSB PDB site
Description: Crystal structure of human Arginase-2 complexed with inhibitor 11d: {(5R)-5-amino-5-carboxy-5-[(3-endo)-8-(3,4-dichlorobenzyl)-8-azabicyclo[3.2.1]oct-3-yl]pentyl}(trihydroxy)borate(1-)
Class: hydrolase/hydrolase inhibitor
Keywords: metalloenzyme,alpha/beta fold, Hydrolase, Arginine metabolism, Manganese,boronate, Mitochondrion, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-01-28, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginase-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ixua_
  • Chain 'B':
    Compound: Arginase-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ixub_
  • Chain 'C':
    Compound: Arginase-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ixuc_
  • Heterogens: MN, BEN, BME, 38I, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ixuA (A:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ixuB (B:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ixuC (C:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg