PDB entry 4ixs

View 4ixs on RCSB PDB site
Description: Native structure of xometc at ph 5.2
Class: lyase
Keywords: PLP DEPENDENT ENZYME, LYASE, XOMETC, Cys-Met metabolism PLP dependent enzyme, cystathionine gamma/beta lyase, PLP Binding
Deposited on 2013-01-28, released 2014-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: metB, XOO0778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ixsa_
  • Chain 'B':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: metB, XOO0778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ixsb_
  • Heterogens: GOL, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ixsA (A:)
    msnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysr
    thnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfe
    rvrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhgl
    ltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqn
    siggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashpqhv
    lakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipv
    arreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ixsA (A:)
    alslatlaihggqspdpstgavmppiyatstyaqsrthnptrfayercvaaleggtrafa
    fasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsfvdltdpaafka
    airadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspmlqrplslgadlv
    vhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsflalrglktlplr
    mrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggivsivlkggfdaa
    krfcektelftlaeslggveslvnhpavmteqlgisdalvrlsvgiedlgdlrgdleral
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ixsB (B:)
    msnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysr
    thnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfe
    rvrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhgl
    ltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqn
    siggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashpqhv
    lakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipv
    arreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ixsB (B:)
    lslatlaihggqspdpstgavmppiyatstyaqsspsrthnptrfayercvaaleggtra
    fafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsfvdltdpaaf
    kaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspmlqrplslgad
    lvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsflalrglktlp
    lrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggivsivlkggfd
    aakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalvrlsvgiedl
    gdlrgdleralv