PDB entry 4ixd

View 4ixd on RCSB PDB site
Description: X-ray structure of lfa-1 i-domain in complex with ibe-667 at 1.8a resolution
Class: immune system
Keywords: rossman-fold, I-domain, immune system
Deposited on 2013-01-25, released 2014-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701
      • see remark 999 (65)
    Domains in SCOPe 2.07: d4ixda_
  • Heterogens: MG, 1HV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ixdA (A:)
    maskgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdf
    sdyvkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeat
    dsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelq
    kkiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ixdA (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vi