PDB entry 4ixa

View 4ixa on RCSB PDB site
Description: Structure of DNA-binding domain of the response regulator SaeR from Staphylococcus epidermidis
Class: transcription
Keywords: transcriptional factor, TRANSCRIPTION
Deposited on 2013-01-24, released 2014-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.206
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator SaeR
    Species: Staphylococcus epidermidis [TaxId:176280]
    Gene: saeR, SE_0479
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CQ17 (0-101)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d4ixaa_
  • Chain 'B':
    Compound: Response regulator SaeR
    Species: Staphylococcus epidermidis [TaxId:176280]
    Gene: saeR, SE_0479
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ixab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ixaA (A:)
    meqlefdglvlknlsktltinnieipmrikefellwylasregevisksellekvwgydy
    yedantvnvhihrireklekhdflpytittvwglgykfersrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ixaA (A:)
    meqlefdglvlknlsktltinnieipmrikefellwylasregevisksellekvwgydy
    yedantvnvhihrireklekhdflpytittvwglgykfersr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ixaB (B:)
    meqlefdglvlknlsktltinnieipmrikefellwylasregevisksellekvwgydy
    yedantvnvhihrireklekhdflpytittvwglgykfersrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ixaB (B:)
    eqlefdglvlknlsktltinnieipmrikefellwylasregevisksellekvwgantv
    nvhihrireklekhdflpytittvwglgykfers