PDB entry 4ix8

View 4ix8 on RCSB PDB site
Description: Crystal structure of Tyrosine aminotransferase from Leishmania infantum
Class: transferase
Keywords: SSGCID, Tyrosine aminotransferase, pyridoxal phosphate, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2013-01-24, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine aminotransferase
    Species: Leishmania infantum [TaxId:5671]
    Gene: LINJ_36_2490, TAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ix8a_
  • Chain 'B':
    Compound: Tyrosine aminotransferase
    Species: Leishmania infantum [TaxId:5671]
    Gene: LINJ_36_2490, TAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ix8b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ix8A (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdrwtsfrriasskhaqrtlqplnnltdnm
    kpsrstksnlrlsigdptvdgnlktpdivteamvdvvrsgkfngypptvgadnlrqvvst
    ywrrfcqtksrqealkwenviitsgvsqaivlaltalcnegdnilvcapsfphyksvcds
    ygiecryyyldpskswecdlraaagmvdshtkafviinpsnpcgsnfsrahvsdiidfcq
    qhqiplisdeiyaemvlnngiftsvadfdtnvprlilggtakyqvcpgwrvgwsilidpm
    nvagdwavgmerltqliagvnsicqeaiartllkcptectehivtqleagakvyarlleh
    digismeapqasmfvmlklnlsyfqdlksdmefyeklldeenvqvlpgeifgmsgflrat
    vsrpsavlneavdriiefcerhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ix8A (A:)
    sfrriasskhaqrtlqplnnltmkpsrstksnlrlsigdptvdgnlktpdivteamvdvv
    rsgkfngypptvgadnlrqvvstywrrfcqtksrqealkwenviitsgvsqaivlaltal
    cnegdnilvcapsfphyksvcdsygiecryyyldpskswecdlraaagmvdshtkafvii
    npsnpcgsnfsrahvsdiidfcqqhqiplisdeiyaemvlnngiftsvadfdtnvprlil
    ggtakyqvcpgwrvgwsilidpmnvagdwavgmerltqliagvnsicqeaiartllkcpt
    ectehivtqleagakvyarllehdigismeapqasmfvmlklnlsyfqdlksdmefyekl
    ldeenvqvlpgeifgmsgflratvsrpsavlneavdriiefcerhkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ix8B (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdrwtsfrriasskhaqrtlqplnnltdnm
    kpsrstksnlrlsigdptvdgnlktpdivteamvdvvrsgkfngypptvgadnlrqvvst
    ywrrfcqtksrqealkwenviitsgvsqaivlaltalcnegdnilvcapsfphyksvcds
    ygiecryyyldpskswecdlraaagmvdshtkafviinpsnpcgsnfsrahvsdiidfcq
    qhqiplisdeiyaemvlnngiftsvadfdtnvprlilggtakyqvcpgwrvgwsilidpm
    nvagdwavgmerltqliagvnsicqeaiartllkcptectehivtqleagakvyarlleh
    digismeapqasmfvmlklnlsyfqdlksdmefyeklldeenvqvlpgeifgmsgflrat
    vsrpsavlneavdriiefcerhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ix8B (B:)
    sfrriasskhaqrtlqplnnltnlrlsigdptvdgnlktpdivteamvdvvrsgkfngyp
    ptvgadnlrqvvstywrrfcqtksrqealkwenviitsgvsqaivlaltalcnegdnilv
    capsfphyksvcdsygiecryyyldpskswecdlraaagmvdshtkafviinpsnpcgsn
    fsrahvsdiidfcqqhqiplisdeiyaemvlnngiftsvadfdtnvprlilggtakyqvc
    pgwrvgwsilidpmnvagdwavgmerltqliagvnsicqeaiartllkcptectehivtq
    leagakvyarllismeapqasmfvmldmefyeklldnvqvlpgeifgmsgflratvsrps
    avlneavdri