PDB entry 4iwk

View 4iwk on RCSB PDB site
Description: Crystal structure of iron soaked (overnight) ferritin from Pseudo-nitzschia multiseries
Class: transport protein
Keywords: ferritin, 4 helix bundle, iron storage, acetamido-cysteines, TRANSPORT PROTEIN
Deposited on 2013-01-23, released 2013-03-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.177
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4iwka_
  • Chain 'B':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4iwkb_
  • Chain 'C':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4iwkc_
  • Chain 'D':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4iwkd_
  • Chain 'E':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4iwke_
  • Chain 'F':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4iwkf_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iwkA (A:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iwkA (A:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iwkB (B:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iwkB (B:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iwkC (C:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iwkC (C:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4iwkD (D:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iwkD (D:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4iwkE (E:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iwkE (E:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4iwkF (F:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iwkF (F:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf