PDB entry 4iwd

View 4iwd on RCSB PDB site
Description: Structure of dually phosphorylated c-MET receptor kinase in complex with an MK-8033 analog
Class: transferase/transferase inhibitor
Keywords: Protein kinase, tyrosine kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-01-23, released 2013-12-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.207
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (1-301)
      • expression tag (0)
      • expression tag (302-305)
    Domains in SCOPe 2.06: d4iwda1, d4iwda2, d4iwda3
  • Heterogens: 1JC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iwdA (A:)
    xqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iwdA (A:)
    xqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkeyysvhnklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntf
    ditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehhh
    hh