PDB entry 4iw9

View 4iw9 on RCSB PDB site
Description: Crystal structure of glutathione s-transferase mha_0454 (target efi-507015) from mannheimia haemolytica, gsh complex
Class: transferase
Keywords: transferase, glutathione, enzyme function initiative, efi
Deposited on 2013-01-23, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.156
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase
    Species: Mannheimia haemolytica PHL213 [TaxId:272629]
    Gene: MHA_0454
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7JQU5 (22-230)
      • expression tag (21)
    Domains in SCOPe 2.07: d4iw9a1, d4iw9a2, d4iw9a3
  • Chain 'B':
    Compound: glutathione transferase
    Species: Mannheimia haemolytica PHL213 [TaxId:272629]
    Gene: MHA_0454
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7JQU5 (22-230)
      • expression tag (16-21)
    Domains in SCOPe 2.07: d4iw9b1, d4iw9b2, d4iw9b3
  • Chain 'C':
    Compound: glutathione transferase
    Species: Mannheimia haemolytica PHL213 [TaxId:272629]
    Gene: MHA_0454
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7JQU5 (22-230)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d4iw9c1, d4iw9c2, d4iw9c3
  • Heterogens: GSH, ACT, PGE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iw9A (A:)
    mhhhhhhssgvdlgtenlyfqsmklygltgacsfvphvalewvklranqdyafqavsref
    iksaeylalnprgnvpllvdgdlaltqnqaivhyldelypeaklfgsktardkakaarwl
    affnsdvhksfvplfrlpsyaegnetltktirqqsaeqileqlafanahlenhiffgeei
    svadaylyimlnwcrllgldfshlsqlsafmqrveadqgvdnvreqeglkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iw9A (A:)
    smklygltgacsfvphvalewvklranqdyafqavsrefiksaeylalnprgnvpllvdg
    dlaltqnqaivhyldelypeaklfgsktardkakaarwlaffnsdvhksfvplfrlpsya
    egnetltktirqqsaeqileqlafanahlenhiffgeeisvadaylyimlnwcrllgldf
    shlsqlsafmqrveadqgvdnvreqeglkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iw9B (B:)
    mhhhhhhssgvdlgtenlyfqsmklygltgacsfvphvalewvklranqdyafqavsref
    iksaeylalnprgnvpllvdgdlaltqnqaivhyldelypeaklfgsktardkakaarwl
    affnsdvhksfvplfrlpsyaegnetltktirqqsaeqileqlafanahlenhiffgeei
    svadaylyimlnwcrllgldfshlsqlsafmqrveadqgvdnvreqeglkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iw9B (B:)
    nlyfqsmklygltgacsfvphvalewvklranqdyafqavsrefiksaeylalnprgnvp
    llvdgdlaltqnqaivhyldelypeaklfgsktardkakaarwlaffnsdvhksfvplfr
    lpsyaegnetltktirqqsaeqileqlafanahlenhiffgeeisvadaylyimlnwcrl
    lgldfshlsqlsafmqrveadqgvdnvreqeglkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iw9C (C:)
    mhhhhhhssgvdlgtenlyfqsmklygltgacsfvphvalewvklranqdyafqavsref
    iksaeylalnprgnvpllvdgdlaltqnqaivhyldelypeaklfgsktardkakaarwl
    affnsdvhksfvplfrlpsyaegnetltktirqqsaeqileqlafanahlenhiffgeei
    svadaylyimlnwcrllgldfshlsqlsafmqrveadqgvdnvreqeglkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iw9C (C:)
    qsmklygltgacsfvphvalewvklranqdyafqavsrefiksaeylalnprgnvpllvd
    gdlaltqnqaivhyldelypeaklfgsktardkakaarwlaffnsdvhksfvplfrgnet
    ltktirqqsaeqileqlafanahlenhiffgeeisvadaylyimlnwcrllgldfshlsq
    lsafmqrveadqgvdnvreqeglkg