PDB entry 4iuy

View 4iuy on RCSB PDB site
Description: Crystal structure of short-chain dehydrogenase/reductase (apo-form) from A. baumannii clinical strain WM99C
Class: oxidoreductase
Keywords: Rossmann Fold, OXIDOREDUCTASE
Deposited on 2013-01-21, released 2013-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.156
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short chain dehydrogenase/reductase
    Species: Acinetobacter baumannii [TaxId:405416]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4IUY
    Domains in SCOPe 2.05: d4iuya_
  • Chain 'B':
    Compound: Short chain dehydrogenase/reductase
    Species: Acinetobacter baumannii [TaxId:405416]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4IUY
    Domains in SCOPe 2.05: d4iuyb_
  • Chain 'C':
    Compound: Short chain dehydrogenase/reductase
    Species: Acinetobacter baumannii [TaxId:405416]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4IUY (Start-273)
    Domains in SCOPe 2.05: d4iuyc_
  • Chain 'D':
    Compound: Short chain dehydrogenase/reductase
    Species: Acinetobacter baumannii [TaxId:405416]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4IUY
    Domains in SCOPe 2.05: d4iuyd_
  • Chain 'E':
    Compound: Short chain dehydrogenase/reductase
    Species: Acinetobacter baumannii [TaxId:405416]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4IUY
    Domains in SCOPe 2.05: d4iuye_
  • Chain 'F':
    Compound: Short chain dehydrogenase/reductase
    Species: Acinetobacter baumannii [TaxId:405416]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4IUY
    Domains in SCOPe 2.05: d4iuyf_
  • Chain 'G':
    Compound: Short chain dehydrogenase/reductase
    Species: Acinetobacter baumannii [TaxId:405416]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4IUY
    Domains in SCOPe 2.05: d4iuyg_
  • Chain 'H':
    Compound: Short chain dehydrogenase/reductase
    Species: Acinetobacter baumannii [TaxId:405416]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4IUY
    Domains in SCOPe 2.05: d4iuyh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iuyA (A:)
    mgsshhhhhhssglvprgsmnifdvkdkyilitgassglghhiaelfakeganivicarr
    lerlkeleshikneygvqvytfaldvndrsavkdmlssleaegvtidvlinnagvsdtkr
    fldyndedwdkivdtnlkapwqcaqevvqhmikaerkgsiinitsilsqstnlgvspyca
    skaglrhltevmavelarfginvnaiapgymiteineeyltsevgqqllkkiptrkfvef
    ddlngpllllasqagqgitgieikvdgghsaapi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuyA (A:)
    nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
    tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
    wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
    invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
    ieikvdgghsaap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iuyB (B:)
    mgsshhhhhhssglvprgsmnifdvkdkyilitgassglghhiaelfakeganivicarr
    lerlkeleshikneygvqvytfaldvndrsavkdmlssleaegvtidvlinnagvsdtkr
    fldyndedwdkivdtnlkapwqcaqevvqhmikaerkgsiinitsilsqstnlgvspyca
    skaglrhltevmavelarfginvnaiapgymiteineeyltsevgqqllkkiptrkfvef
    ddlngpllllasqagqgitgieikvdgghsaapi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuyB (B:)
    nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
    tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
    wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
    invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
    ieikvdgghsaap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iuyC (C:)
    mgsshhhhhhssglvprgsmnifdvkdkyilitgassglghhiaelfakeganivicarr
    lerlkeleshikneygvqvytfaldvndrsavkdmlssleaegvtidvlinnagvsdtkr
    fldyndedwdkivdtnlkapwqcaqevvqhmikaerkgsiinitsilsqstnlgvspyca
    skaglrhltevmavelarfginvnaiapgymiteineeyltsevgqqllkkiptrkfvef
    ddlngpllllasqagqgitgieikvdgghsaapi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuyC (C:)
    nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
    tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
    wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
    invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
    ieikvdgghsaapi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4iuyD (D:)
    mgsshhhhhhssglvprgsmnifdvkdkyilitgassglghhiaelfakeganivicarr
    lerlkeleshikneygvqvytfaldvndrsavkdmlssleaegvtidvlinnagvsdtkr
    fldyndedwdkivdtnlkapwqcaqevvqhmikaerkgsiinitsilsqstnlgvspyca
    skaglrhltevmavelarfginvnaiapgymiteineeyltsevgqqllkkiptrkfvef
    ddlngpllllasqagqgitgieikvdgghsaapi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuyD (D:)
    nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
    tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
    wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
    invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
    ieikvdgghsaap
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4iuyE (E:)
    mgsshhhhhhssglvprgsmnifdvkdkyilitgassglghhiaelfakeganivicarr
    lerlkeleshikneygvqvytfaldvndrsavkdmlssleaegvtidvlinnagvsdtkr
    fldyndedwdkivdtnlkapwqcaqevvqhmikaerkgsiinitsilsqstnlgvspyca
    skaglrhltevmavelarfginvnaiapgymiteineeyltsevgqqllkkiptrkfvef
    ddlngpllllasqagqgitgieikvdgghsaapi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuyE (E:)
    nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
    tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
    wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
    invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
    ieikvdgghsaap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4iuyF (F:)
    mgsshhhhhhssglvprgsmnifdvkdkyilitgassglghhiaelfakeganivicarr
    lerlkeleshikneygvqvytfaldvndrsavkdmlssleaegvtidvlinnagvsdtkr
    fldyndedwdkivdtnlkapwqcaqevvqhmikaerkgsiinitsilsqstnlgvspyca
    skaglrhltevmavelarfginvnaiapgymiteineeyltsevgqqllkkiptrkfvef
    ddlngpllllasqagqgitgieikvdgghsaapi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuyF (F:)
    nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
    tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
    wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
    invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
    ieikvdgghsaap
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4iuyG (G:)
    mgsshhhhhhssglvprgsmnifdvkdkyilitgassglghhiaelfakeganivicarr
    lerlkeleshikneygvqvytfaldvndrsavkdmlssleaegvtidvlinnagvsdtkr
    fldyndedwdkivdtnlkapwqcaqevvqhmikaerkgsiinitsilsqstnlgvspyca
    skaglrhltevmavelarfginvnaiapgymiteineeyltsevgqqllkkiptrkfvef
    ddlngpllllasqagqgitgieikvdgghsaapi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuyG (G:)
    nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
    tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
    wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
    invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
    ieikvdgghsaap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4iuyH (H:)
    mgsshhhhhhssglvprgsmnifdvkdkyilitgassglghhiaelfakeganivicarr
    lerlkeleshikneygvqvytfaldvndrsavkdmlssleaegvtidvlinnagvsdtkr
    fldyndedwdkivdtnlkapwqcaqevvqhmikaerkgsiinitsilsqstnlgvspyca
    skaglrhltevmavelarfginvnaiapgymiteineeyltsevgqqllkkiptrkfvef
    ddlngpllllasqagqgitgieikvdgghsaapi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuyH (H:)
    nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
    tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
    wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
    invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
    ieikvdgghsaap