PDB entry 4iun

View 4iun on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS R126E at cryogenic temperature
Class: hydrolase
Keywords: nuclease, hyperstable, pdTp, ion pair, HYDROLASE
Deposited on 2013-01-21, released 2013-02-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.152
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • engineered mutation (43-44)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (119)
      • engineered mutation (121)
    Domains in SCOPe 2.05: d4iuna_
  • Heterogens: CA, THP, PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iunA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqlle
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iunA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqlle
    kaeaqakkeklniwse