PDB entry 4iua

View 4iua on RCSB PDB site
Description: Crystal Structure of the NK2 Fragment (31-290) of the mouse Hepatocyte Growth Factor/Scatter Factor
Class: hormone
Keywords: HGF/SF, HORMONE, KRINGLE domain, GROWTH FACTOR
Deposited on 2013-01-20, released 2013-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatocyte growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Hgf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08048 (Start-261)
      • engineered mutation (186)
    Domains in SCOPe 2.07: d4iuaa1, d4iuaa2, d4iuaa3
  • Chain 'B':
    Compound: hepatocyte growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Hgf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08048 (Start-261)
      • engineered mutation (186)
    Domains in SCOPe 2.07: d4iuab1, d4iuab2, d4iuab3
  • Chain 'C':
    Compound: hepatocyte growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Hgf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08048 (Start-261)
      • engineered mutation (186)
    Domains in SCOPe 2.07: d4iuac1, d4iuac2, d4iuac3
  • Chain 'D':
    Compound: hepatocyte growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Hgf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08048 (Start-261)
      • engineered mutation (186)
    Domains in SCOPe 2.07: d4iuad1, d4iuad2, d4iuad3
  • Chain 'E':
    Compound: hepatocyte growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Hgf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08048 (Start-261)
      • engineered mutation (186)
    Domains in SCOPe 2.07: d4iuae1, d4iuae2, d4iuae3
  • Chain 'F':
    Compound: hepatocyte growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Hgf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08048 (Start-261)
      • engineered mutation (186)
    Domains in SCOPe 2.07: d4iuaf1, d4iuaf2, d4iuaf3
  • Chain 'G':
    Compound: hepatocyte growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Hgf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08048 (Start-261)
      • engineered mutation (186)
    Domains in SCOPe 2.07: d4iuag1, d4iuag2, d4iuag3
  • Chain 'H':
    Compound: hepatocyte growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Hgf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08048 (Start-261)
      • engineered mutation (186)
    Domains in SCOPe 2.07: d4iuah1, d4iuah2, d4iuah3
  • Heterogens: EPE, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iuaA (A:)
    gsegqkkrrntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckaf
    vfdksrkrcywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgi
    kcqpwnsmiphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcs
    evecmtangesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkp
    rpwcytldpdtpweycaiktca
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuaA (A:)
    rntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkr
    cywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgikcqpwnsm
    iphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsevecmtan
    gesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkprpwcytld
    pdtpweycaiktca
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iuaB (B:)
    gsegqkkrrntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckaf
    vfdksrkrcywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgi
    kcqpwnsmiphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcs
    evecmtangesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkp
    rpwcytldpdtpweycaiktca
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuaB (B:)
    rntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkr
    cywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgikcqpwnsm
    iphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsevecmtan
    gesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkprpwcytld
    pdtpweycaiktca
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iuaC (C:)
    gsegqkkrrntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckaf
    vfdksrkrcywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgi
    kcqpwnsmiphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcs
    evecmtangesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkp
    rpwcytldpdtpweycaiktca
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuaC (C:)
    rntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkr
    cywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgikcqpwnsm
    iphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsevecmtan
    gesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkprpwcytld
    pdtpweycaiktca
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4iuaD (D:)
    gsegqkkrrntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckaf
    vfdksrkrcywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgi
    kcqpwnsmiphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcs
    evecmtangesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkp
    rpwcytldpdtpweycaiktca
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuaD (D:)
    rntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkr
    cywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgikcqpwnsm
    iphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsevecmtan
    gesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkprpwcytld
    pdtpweycaiktca
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4iuaE (E:)
    gsegqkkrrntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckaf
    vfdksrkrcywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgi
    kcqpwnsmiphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcs
    evecmtangesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkp
    rpwcytldpdtpweycaiktca
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuaE (E:)
    rntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkr
    cywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgikcqpwnsm
    iphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsevecmtan
    gesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkprpwcytld
    pdtpweycaiktca
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4iuaF (F:)
    gsegqkkrrntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckaf
    vfdksrkrcywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgi
    kcqpwnsmiphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcs
    evecmtangesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkp
    rpwcytldpdtpweycaiktca
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuaF (F:)
    rntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkr
    cywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgikcqpwnsm
    iphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsevecmtan
    gesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkprpwcytld
    pdtpweycaiktca
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4iuaG (G:)
    gsegqkkrrntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckaf
    vfdksrkrcywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgi
    kcqpwnsmiphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcs
    evecmtangesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkp
    rpwcytldpdtpweycaiktca
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuaG (G:)
    ntlhefkksakttltkdpllkiktkkvnsadecanrctftckafvfdksrkrcywypfns
    mssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgikcqpwnsmiphehsfl
    pssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsevecmtangesyrgpm
    dhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkprpwcytldpdtpweyc
    aiktca
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4iuaH (H:)
    gsegqkkrrntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckaf
    vfdksrkrcywypfnsmssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgi
    kcqpwnsmiphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcs
    evecmtangesyrgpmdhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkp
    rpwcytldpdtpweycaiktca
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iuaH (H:)
    tlhefkksakttltkiktkkvnsadecanrcirnrgftftckafvfdksrkrcywypfns
    mssgvkkgfghefdlyenkdyirnciigkggsykgtvsitksgikcqpwnsmiphehsfl
    pssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsevecmtangesyrgpm
    dhtesgktcqrwdqqtphrhkflperypdkgfddnycrnpdgkprpwcytldpdtpweyc
    aiktca