PDB entry 4itt

View 4itt on RCSB PDB site
Description: Crystal structure of iron soaked (5 min) ferritin from Pseudo-nitzschia multiseries
Class: transport protein
Keywords: ferritin, 4 helix bundle, iron storage, acetamido-cysteines, TRANSPORT PROTEIN
Deposited on 2013-01-18, released 2013-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4itta_
  • Chain 'B':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ittb_
  • Chain 'C':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ittc_
  • Chain 'D':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ittd_
  • Chain 'E':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4itte_
  • Chain 'F':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ittf_
  • Chain 'G':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ittg_
  • Chain 'H':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4itth_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ittA (A:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ittA (A:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ittB (B:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ittB (B:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ittC (C:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ittC (C:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ittD (D:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ittD (D:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ittE (E:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ittE (E:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ittF (F:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ittF (F:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ittG (G:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ittG (G:)
    elldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfankr
    nipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaflnp
    fhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ittH (H:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ittH (H:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvs