PDB entry 4itk

View 4itk on RCSB PDB site
Description: The structure of C.reinhardtii Ferredoxin 2
Class: electron transport
Keywords: ferredoxin fold, FERREDOXIN, iron-sulfur, ELECTRON TRANSPORT
Deposited on 2013-01-18, released 2014-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.11
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoferredoxin
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: FDX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2HZ25 (1-93)
      • initiating methionine (0)
      • expression tag (94-103)
    Domains in SCOPe 2.07: d4itka1, d4itka2
  • Heterogens: FES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4itkA (A:)
    mfkvtfktpkgektidveadkylldaaeeagmdlpyscrsggcstccgklesgtvdqsdq
    nmldedqlkqgfvltcvayptsdiviltdqesklpiggsenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4itkA (A:)
    mfkvtfktpkgektidveadkylldaaeeagmdlpyscrsggcstccgklesgtvdqsdq
    nmldedqlkqgfvltcvayptsdiviltdqesklpiggsenlyf