PDB entry 4itg

View 4itg on RCSB PDB site
Description: P113S mutant of E. coli Cystathionine beta-lyase MetC
Class: lyase
Keywords: Cystathionine beta-lyase, PLP adduct (LLP residue at amino acid 210), LYASE
Deposited on 2013-01-18, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.162
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine beta-lyase MetC
    Species: Escherichia coli [TaxId:83333]
    Gene: b3008, JW2975, metC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06721 (Start-394)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d4itga_
  • Chain 'B':
    Compound: Cystathionine beta-lyase MetC
    Species: Escherichia coli [TaxId:83333]
    Gene: b3008, JW2975, metC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06721 (Start-394)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d4itgb_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4itgA (A:)
    madkkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrg
    tlthfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayessqdfcsk
    ilsklgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpda
    iimidntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylm
    gqmvdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefw
    krdftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairp
    qgeidfsgtlirlhigledvddliadldagfariv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4itgA (A:)
    kldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlth
    fslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayessqdfcskilsk
    lgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiimi
    dntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqmv
    dadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrdf
    tgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqgei
    dfsgtlirlhigledvddliadldagfariv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4itgB (B:)
    madkkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrg
    tlthfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayessqdfcsk
    ilsklgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpda
    iimidntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylm
    gqmvdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefw
    krdftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairp
    qgeidfsgtlirlhigledvddliadldagfariv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4itgB (B:)
    kkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlt
    hfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayessqdfcskils
    klgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiim
    idntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqm
    vdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrd
    ftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqge
    idfsgtlirlhigledvddliadldagfariv