PDB entry 4it8

View 4it8 on RCSB PDB site
Description: A sperm whale myoglobin mutant L29H Mb with two distal histidines
Class: oxygen storage
Keywords: L29H mutation, alpha helix holding, NO2 reductase, Heme, OXYGEN STORAGE
Deposited on 2013-01-18, released 2013-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (Start-153)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d4it8a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4it8A (A:)
    mvlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4it8A (A:)
    vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg