PDB entry 4isy

View 4isy on RCSB PDB site
Description: Crystal structure of IscS from Mycobacterium tuberculosis
Class: transferase
Keywords: Desulfurase, PLP cofactor, TRANSFERASE
Deposited on 2013-01-17, released 2014-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.189
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: iscS, MT3109, Rv3025c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53272 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.07: d4isya1, d4isya2
  • Chain 'B':
    Compound: Cysteine desulfurase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: iscS, MT3109, Rv3025c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53272 (12-End)
      • expression tag (10-11)
    Domains in SCOPe 2.07: d4isyb1, d4isyb2
  • Chain 'C':
    Compound: Cysteine desulfurase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: iscS, MT3109, Rv3025c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53272 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.07: d4isyc1, d4isyc2
  • Chain 'D':
    Compound: Cysteine desulfurase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: iscS, MT3109, Rv3025c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53272 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.07: d4isyd1, d4isyd2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4isyA (A:)
    mrgshhhhhhgsayldhaattpmhpaaieamaavqrtignasslhtsgrsarrrieeare
    liadklgarpseviftaggtesdnlavkgiywarrdaephrrrivttevehhavldsvnw
    lvehegahvtwlptaadgsvsatalrealqshddvalvsvmwannevgtilpiaemsvva
    mefgvpmhsdaiqavgqlpldfgasglsamsvaghkfggppgvgalllrrdvtcvplmhg
    ggqerdirsgtpdvasavgmataaqiavdgleensarlrllrdrlvegvlaeiddvclng
    addpmrlagnahftfrgcegdallmlldangiecstgsactagvaqpshvliamgvdaas
    argslrlslghtsveadvdaalevlpgavararraalaaagasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4isyA (A:)
    sayldhaattpmhpaaieamaavqrtignasslhtsgrsarrrieeareliadklgarps
    eviftaggtesdnlavkgiywarrdaephrrrivttevehhavldsvnwlvehegahvtw
    lptaadgsvsatalrealqshddvalvsvmwannevgtilpiaemsvvamefgvpmhsda
    iqavgqlpldfgasglsamsvaghkfggppgvgalllrrdvtcvplmhgggqerdirsgt
    pdvasavgmataaqiavdgleensarlrllrdrlvegvlaeiddvclngaddpmrlagna
    hftfrgcegdallmlldangiecstgspshvliamgvdaasargslrlslghtsveadvd
    aalevlpgavararraala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4isyB (B:)
    mrgshhhhhhgsayldhaattpmhpaaieamaavqrtignasslhtsgrsarrrieeare
    liadklgarpseviftaggtesdnlavkgiywarrdaephrrrivttevehhavldsvnw
    lvehegahvtwlptaadgsvsatalrealqshddvalvsvmwannevgtilpiaemsvva
    mefgvpmhsdaiqavgqlpldfgasglsamsvaghkfggppgvgalllrrdvtcvplmhg
    ggqerdirsgtpdvasavgmataaqiavdgleensarlrllrdrlvegvlaeiddvclng
    addpmrlagnahftfrgcegdallmlldangiecstgsactagvaqpshvliamgvdaas
    argslrlslghtsveadvdaalevlpgavararraalaaagasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4isyB (B:)
    gsayldhaattpmhpaaieamaavqrtignasslhtsgrsarrrieeareliadklgarp
    seviftaggtesdnlavkgiywarrdaephrrrivttevehhavldsvnwlvehegahvt
    wlptaadgsvsatalrealqshddvalvsvmwannevgtilpiaemsvvamefgvpmhsd
    aiqavgqlpldfgasglsamsvaghkfggppgvgalllrrdvtcvplmhgggqerdirsg
    tpdvasavgmataaqiavdgleensarlrllrdrlvegvlaeiddvclngaddpmrlagn
    ahftfrgcegdallmlldangiecstgspshvliamgvdaasargslrlslghtsveadv
    daalevlpgavararraal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4isyC (C:)
    mrgshhhhhhgsayldhaattpmhpaaieamaavqrtignasslhtsgrsarrrieeare
    liadklgarpseviftaggtesdnlavkgiywarrdaephrrrivttevehhavldsvnw
    lvehegahvtwlptaadgsvsatalrealqshddvalvsvmwannevgtilpiaemsvva
    mefgvpmhsdaiqavgqlpldfgasglsamsvaghkfggppgvgalllrrdvtcvplmhg
    ggqerdirsgtpdvasavgmataaqiavdgleensarlrllrdrlvegvlaeiddvclng
    addpmrlagnahftfrgcegdallmlldangiecstgsactagvaqpshvliamgvdaas
    argslrlslghtsveadvdaalevlpgavararraalaaagasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4isyC (C:)
    sayldhaattpmhpaaieamaavqrtignasslhtsgrsarrrieeareliadklgarps
    eviftaggtesdnlavkgiywarrdaephrrrivttevehhavldsvnwlvehegahvtw
    lptaadgsvsatalrealqshddvalvsvmwannevgtilpiaemsvvamefgvpmhsda
    iqavgqlpldfgasglsamsvaghkfggppgvgalllrrdvtcvplmhgggqerdirsgt
    pdvasavgmataaqiavdgleensarlrllrdrlvegvlaeiddvclngaddpmrlagna
    hftfrgcegdallmlldangiecstgsapshvliamgvdaasargslrlslghtsveadv
    daalevlpgavararraalaaag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4isyD (D:)
    mrgshhhhhhgsayldhaattpmhpaaieamaavqrtignasslhtsgrsarrrieeare
    liadklgarpseviftaggtesdnlavkgiywarrdaephrrrivttevehhavldsvnw
    lvehegahvtwlptaadgsvsatalrealqshddvalvsvmwannevgtilpiaemsvva
    mefgvpmhsdaiqavgqlpldfgasglsamsvaghkfggppgvgalllrrdvtcvplmhg
    ggqerdirsgtpdvasavgmataaqiavdgleensarlrllrdrlvegvlaeiddvclng
    addpmrlagnahftfrgcegdallmlldangiecstgsactagvaqpshvliamgvdaas
    argslrlslghtsveadvdaalevlpgavararraalaaagasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4isyD (D:)
    sayldhaattpmhpaaieamaavqrtignasslhtsgrsarrrieeareliadklgarps
    eviftaggtesdnlavkgiywarrdaephrrrivttevehhavldsvnwlvehegahvtw
    lptaadgsvsatalrealqshddvalvsvmwannevgtilpiaemsvvamefgvpmhsda
    iqavgqlpldfgasglsamsvaghkfggppgvgalllrrdvtcvplmhgggqerdirsgt
    pdvasavgmataaqiavdgleensarlrllrdrlvegvlaeiddvclngaddpmrlagna
    hftfrgcegdallmlldangiecstgspshvliamgvdaasargslrlslghtsveadvd
    aalevlpgavararraalaaa