PDB entry 4isx

View 4isx on RCSB PDB site
Description: The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
Class: transferase
Keywords: structural genomics, center for structural genomics of infectious diseases, csgid, niaid, national institute of allergy and infectious diseases, transferase
Deposited on 2013-01-17, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.197
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose o-acetyltransferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: Clostridium difficile, maa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18A66 (3-187)
      • expression tag (2)
    Domains in SCOPe 2.07: d4isxa1, d4isxa2
  • Chain 'B':
    Compound: maltose o-acetyltransferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: Clostridium difficile, maa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4isxb_
  • Heterogens: ACO, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4isxA (A:)
    snamtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvg
    kqinveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpida
    qlrnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpc
    rvikkiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4isxA (A:)
    amtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvgkq
    inveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpidaql
    rnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpcrv
    ikkiee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4isxB (B:)
    snamtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvg
    kqinveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpida
    qlrnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpc
    rvikkiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4isxB (B:)
    mtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvgkqi
    nveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpidaqlr
    nsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpcrvi
    kkiee