PDB entry 4isp

View 4isp on RCSB PDB site
Description: Crystal structure of iron soaked (4h) ferritin from Pseudo-nitzschia multiseries
Class: transport protein
Keywords: ferritin, 4 helix bundle, iron storage, cysteine alkylation, TRANSPORT PROTEIN
Deposited on 2013-01-17, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ispa_
  • Chain 'B':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ispb_
  • Chain 'C':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ispc_
  • Chain 'D':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ispd_
  • Chain 'E':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ispe_
  • Chain 'F':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ispf_
  • Chain 'G':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ispg_
  • Chain 'H':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4isph_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ispA (A:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ispA (A:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ispB (B:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ispB (B:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ispC (C:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ispC (C:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ispD (D:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ispD (D:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ispE (E:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ispE (E:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ispF (F:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ispF (F:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ispG (G:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ispG (G:)
    elldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfankr
    nipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaflnp
    fhlqqvneedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ispH (H:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvneedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ispH (H:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf