PDB entry 4isj

View 4isj on RCSB PDB site
Description: RNA Ligase RtcB in complex with Mn(II)
Class: ligase
Keywords: RNA ligase, LIGASE
Deposited on 2013-01-16, released 2013-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-splicing ligase RtcB
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1602, rtcB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4isja_
  • Chain 'B':
    Compound: tRNA-splicing ligase RtcB
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1602, rtcB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4isjb_
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4isjA (A:)
    mvvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykys
    ivmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlv
    dtlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadp
    eavsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrgl
    ghqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmit
    hwvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppg
    heavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyr
    gdrirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvak
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >4isjA (A:)
    vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
    vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
    tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe
    avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg
    hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith
    wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh
    eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg
    drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4isjB (B:)
    mvvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykys
    ivmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlv
    dtlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadp
    eavsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrgl
    ghqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmit
    hwvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppg
    heavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyr
    gdrirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvak
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >4isjB (B:)
    vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
    vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
    tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe
    avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg
    hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith
    wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh
    eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg
    drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg