PDB entry 4is7

View 4is7 on RCSB PDB site
Description: Crystal Structure of the CASKIN2 SAM Domain Tandem
Class: protein binding
Keywords: sterile alpha motif, scaffolding protein, SAM domain, protein binding
Deposited on 2013-01-16, released 2014-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.251
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caskin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CASKIN2, KIAA1139
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WXE0
      • conflict (26)
    Domains in SCOPe 2.07: d4is7a1, d4is7a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4is7A (A:)
    gsshhhhhhssglvprgshmeqllegadaqaihnwlsefqlegytahflqagydvptisr
    mtpedltaigvtkpghrkkiaseiaqlsiaewlpsyiptdllewlcalglpqyhkqlvss
    gydsmglvadltweelqeigvnklghqkklmlgvkrlaelrrgllqgeals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4is7A (A:)
    gadaqaihnwlsefqlegytahflqagydvptisrmtpedltaigvtkpghrkkiaseia
    qlsiaewlpsyiptdllewlcalglpqyhkqlvssgydsmglvadltweelqeigvnklg
    hqkklmlgvkrlaelrrgll