PDB entry 4ir3

View 4ir3 on RCSB PDB site
Description: Crystal Structure of the bromodomain of human BAZ2B in complex with 1-[7-amino-1-(pyrimidin-2-yl)indolizin-3-yl]ethanone (GSK2833282A)
Class: transcription
Keywords: SGC, Structural Genomics Consortium, TRANSCRIPTION, bromodomain, acetylated lysine binding protein, KIAA1476, WALp4
Deposited on 2013-01-14, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain adjacent to zinc finger domain protein 2B
  Species: Homo sapiens [TaxId:9606]
  Gene: BAZ2B, KIAA1476
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UIF8 (2-End)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d4ir3a1, d4ir3a2
• Heterogens: EDO, GOL, 1FK, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4ir3A (A:)
  smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
  eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4ir3A (A:)
  smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
  eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv