PDB entry 4ir3
View 4ir3 on RCSB PDB site
Description: Crystal Structure of the bromodomain of human BAZ2B in complex with 1-[7-amino-1-(pyrimidin-2-yl)indolizin-3-yl]ethanone (GSK2833282A)
Class: transcription
Keywords: SGC, Structural Genomics Consortium, TRANSCRIPTION, bromodomain, acetylated lysine binding protein, KIAA1476, WALp4
Deposited on
2013-01-14, released
2013-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated
2016-04-20, with a file datestamp of
2016-04-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain adjacent to zinc finger domain protein 2B
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2B, KIAA1476
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4ir3a1, d4ir3a2 - Heterogens: EDO, GOL, 1FK, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4ir3A (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
Sequence, based on observed residues (ATOM records): (download)
>4ir3A (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv