PDB entry 4iqv

View 4iqv on RCSB PDB site
Description: Tdt core in complex with inhibitor 6-[4-(3-fluorobenzoyl)-1H-pyrrol-2-yl]-2-hydroxy-4-oxohexa-2,5-dienoic acid and ssDNA
Class: transferase/transferase inhibitor/DNA
Keywords: terminal transferase, TRANSFERASE-TRANSFERASE INHIBITOR-DNA complex
Deposited on 2013-01-13, released 2013-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA nucleotidylexotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: DNTT, TDT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09838 (Start-352)
      • engineered mutation (268)
    • Uniprot P09838 (353-380)
    Domains in SCOPe 2.07: d4iqva1, d4iqva2, d4iqva3
  • Chain 'C':
    Compound: 5'-d(*gp*cp*cp*g)-3'
  • Heterogens: NA, 1FO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iqvA (A:)
    hmspspvpgsqnvpapavkkisqyacqrrttlnnynqlftdaldilaendelrenegscl
    afmrassvlkslpfpitsmkdtegipclgdkvksiiegiiedgesseakavlnderyksf
    klftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeae
    avsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfw
    kqqglllycdilestfekfkqpsrkvdaadhfqkcflilkldhgrvhseksgqqegkgwk
    airvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtkrvfleae
    seeeifahlgldyiepwernamgsshhhhhhssglvprgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iqvA (A:)
    kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
    mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
    rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
    vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfek
    fkqpsrkvdaadhfqkcflilkldhgrvhsekegkgwkairvdlvmcpydrrafallgwt
    gsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwerna
    

  • Chain 'C':
    No sequence available.