PDB entry 4iqf

View 4iqf on RCSB PDB site
Description: Crystal Structure of Methyionyl-tRNA Formyltransferase from Bacillus anthracis
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta structure, TRANSFERASE
Deposited on 2013-01-11, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.183
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA formyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3717, BA_4004, fmt, GBAA_4004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81WH2 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4iqfa1, d4iqfa2, d4iqfa3
  • Chain 'B':
    Compound: Methionyl-tRNA formyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3717, BA_4004, fmt, GBAA_4004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81WH2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4iqfb1, d4iqfb2, d4iqfb3
  • Chain 'C':
    Compound: Methionyl-tRNA formyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3717, BA_4004, fmt, GBAA_4004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81WH2 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4iqfc1, d4iqfc2, d4iqfc3
  • Chain 'D':
    Compound: Methionyl-tRNA formyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3717, BA_4004, fmt, GBAA_4004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81WH2 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4iqfd1, d4iqfd2, d4iqfd3
  • Heterogens: PG5, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iqfA (A:)
    snamikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhg
    ipvlqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrg
    gapihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahll
    sktvplliqgklepikqneeevtfaynikreqekidwtktgeevynhirglnpwpvaytt
    lagqvvkvwwgekvpvtksaeagtivaieedgfvvatgnetgvkitelqpsgkkrmscsq
    flrgtkpeigtklgena
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iqfA (A:)
    snamikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhg
    ipvlqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrg
    gapihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahll
    sktvplliqgklepikqneeevtfaynikreqekidwtktgeevynhirglnpwpvaytt
    lagqvvkvwwgekvpvtksaeagtivaieedgfvvatgnetgvkitelqpsgkkrmscsq
    flrgtkpeigtklg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iqfB (B:)
    snamikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhg
    ipvlqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrg
    gapihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahll
    sktvplliqgklepikqneeevtfaynikreqekidwtktgeevynhirglnpwpvaytt
    lagqvvkvwwgekvpvtksaeagtivaieedgfvvatgnetgvkitelqpsgkkrmscsq
    flrgtkpeigtklgena
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iqfB (B:)
    namikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhgi
    pvlqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrgg
    apihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahlls
    ktvplliqgklepikqneeevtfaynikreqekidwtktgeevynhirglnpwpvayttl
    agqvvkvwwgekvpvtksaeagtivaieedgfvvatgnetgvkitelqpsgkkrmscsqf
    lrgtkpeigtklge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iqfC (C:)
    snamikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhg
    ipvlqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrg
    gapihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahll
    sktvplliqgklepikqneeevtfaynikreqekidwtktgeevynhirglnpwpvaytt
    lagqvvkvwwgekvpvtksaeagtivaieedgfvvatgnetgvkitelqpsgkkrmscsq
    flrgtkpeigtklgena
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iqfC (C:)
    snamikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhg
    ipvlqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrg
    gapihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahll
    sktvplliqgklepikqneeevtfaynikreqekidwtktgeevynhirglnpwpvaytt
    lagqvvkvwwgekvpvtksaeagtivaieedgfvvatgnetgvkitelqpsgkkrmscsq
    flrgtkpeigtklge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4iqfD (D:)
    snamikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhg
    ipvlqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrg
    gapihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahll
    sktvplliqgklepikqneeevtfaynikreqekidwtktgeevynhirglnpwpvaytt
    lagqvvkvwwgekvpvtksaeagtivaieedgfvvatgnetgvkitelqpsgkkrmscsq
    flrgtkpeigtklgena
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iqfD (D:)
    snamikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhg
    ipvlqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrg
    gapihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahll
    sktvplliqgklepikqneeevtfaynikreqekidwtktgeevynhirglnpwpvaytt
    lagqvvkvwwgekvpvtksaeagtivaieedgfvvatgnetgvkitelqpsgkkrmscsq
    flrgtkpeigtklge