PDB entry 4iqc

View 4iqc on RCSB PDB site
Description: P3121 crystal form of FKBP12.6
Class: isomerase
Keywords: fkbp12.6, isomerase
Deposited on 2013-01-11, released 2014-01-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptidyl-prolyl cis-trans isomerase fkbp1b
  Species: Homo sapiens [TaxId:9606]
  Gene: FKBP1B, FKBP12.6, FKBP1L, FKBP9, OTK4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68106 (0-106)
    • engineered mutation (21)
    • engineered mutation (75)
  Domains in SCOPe 2.03: d4iqca_
• Chain 'B':
  Compound: peptidyl-prolyl cis-trans isomerase fkbp1b
  Species: Homo sapiens [TaxId:9606]
  Gene: FKBP1B, FKBP12.6, FKBP1L, FKBP9, OTK4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68106 (0-106)
    • engineered mutation (21)
    • engineered mutation (75)
  Domains in SCOPe 2.03: d4iqcb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4iqcA (A:)
  gveietispgdgrtfpkkgqtvvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgfe
  egaaqmslgqrakltitpdvaygatghpgvippnatlifdvellnle
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4iqcB (B:)
  gveietispgdgrtfpkkgqtvvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgfe
  egaaqmslgqrakltitpdvaygatghpgvippnatlifdvellnle