PDB entry 4iq6

View 4iq6 on RCSB PDB site
Description: Gsk-3beta with inhibitor 6-chloro-N-cyclohexyl-4-(1H-pyrrolo[2,3-b]pyridin-3-yl)pyridin-2-amine
Class: Transferase/Transferase Inhibitor
Keywords: protein kinase, Transferase-Transferase Inhibitor complex
Deposited on 2013-01-10, released 2013-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iq6a_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iq6b_
  • Heterogens: IQ6

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iq6A (A:)
    gamgshmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqev
    sytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlry
    ffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihs
    fgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdy
    tssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfp
    qikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngr
    dtpalfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasa
    sasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iq6A (A:)
    vttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknr
    elqimrkldhcnivrlryffysylnlvldyvpetvyrvarhysrakqtlpviyvklymyq
    lfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyra
    pelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqirem
    npwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpa
    lfnfttqelssnpplatilippha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iq6B (B:)
    gamgshmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqev
    sytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlry
    ffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihs
    fgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdy
    tssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfp
    qikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngr
    dtpalfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasa
    sasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iq6B (B:)
    vttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknr
    elqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvklym
    yqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryy
    rapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqir
    emfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvkl
    pngrdtpalfnfttqelssnpplatilippha