PDB entry 4iq1

View 4iq1 on RCSB PDB site
Description: Crystal structure of glutathione s-transferase MHA_0454 (TARGET EFI-507015) FROM Mannheimia haemolytica, SUBSTRATE-FREE
Class: transferase
Keywords: transferase, glutathione, enzyme function initiative, efi
Deposited on 2013-01-10, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.176
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase
    Species: Mannheimia haemolytica PHL213 [TaxId:272629]
    Gene: MHA_0454
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7JQU5 (22-End)
      • expression tag (21)
    Domains in SCOPe 2.07: d4iq1a1, d4iq1a2, d4iq1a3
  • Chain 'B':
    Compound: glutathione transferase
    Species: Mannheimia haemolytica PHL213 [TaxId:272629]
    Gene: MHA_0454
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7JQU5 (22-230)
      • expression tag (17-21)
    Domains in SCOPe 2.07: d4iq1b1, d4iq1b2, d4iq1b3
  • Chain 'C':
    Compound: glutathione transferase
    Species: Mannheimia haemolytica PHL213 [TaxId:272629]
    Gene: MHA_0454
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7JQU5 (22-230)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d4iq1c1, d4iq1c2, d4iq1c3
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iq1A (A:)
    mhhhhhhssgvdlgtenlyfqsmklygltgacsfvphvalewvklranqdyafqavsref
    iksaeylalnprgnvpllvdgdlaltqnqaivhyldelypeaklfgsktardkakaarwl
    affnsdvhksfvplfrlpsyaegnetltktirqqsaeqileqlafanahlenhiffgeei
    svadaylyimlnwcrllgldfshlsqlsafmqrveadqgvdnvreqeglkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iq1A (A:)
    smklygltgacsfvphvalewvklranqdyafqavsrefiksaeylalnprgnvpllvdg
    dlaltqnqaivhyldelypeaklfgsktardkakaarwlaffnsdvhksfvplfrlpsya
    egnetltktirqqsaeqileqlafanahlenhiffgeeisvadaylyimlnwcrllgldf
    shlsqlsafmqrveadqgvdnvreqeglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iq1B (B:)
    mhhhhhhssgvdlgtenlyfqsmklygltgacsfvphvalewvklranqdyafqavsref
    iksaeylalnprgnvpllvdgdlaltqnqaivhyldelypeaklfgsktardkakaarwl
    affnsdvhksfvplfrlpsyaegnetltktirqqsaeqileqlafanahlenhiffgeei
    svadaylyimlnwcrllgldfshlsqlsafmqrveadqgvdnvreqeglkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iq1B (B:)
    lyfqsmklygltgacsfvphvalewvklranqdyafqavsrefiksaeylalnprgnvpl
    lvdgdlaltqnqaivhyldelypeaklfgsktardkakaarwlaffnsdvhksfvplfrl
    psyaegnetltktirqqsaeqileqlafanahlenhiffgeeisvadaylyimlnwcrll
    gldfshlsqlsafmqrveadqgvdnvreqeglkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iq1C (C:)
    mhhhhhhssgvdlgtenlyfqsmklygltgacsfvphvalewvklranqdyafqavsref
    iksaeylalnprgnvpllvdgdlaltqnqaivhyldelypeaklfgsktardkakaarwl
    affnsdvhksfvplfrlpsyaegnetltktirqqsaeqileqlafanahlenhiffgeei
    svadaylyimlnwcrllgldfshlsqlsafmqrveadqgvdnvreqeglkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iq1C (C:)
    qsmklygltgacsfvphvalewvklranqdyafqavsrefiksaeylalnprgnvpllvd
    gdlaltqnqaivhyldelypeaklfgsktardkakaarwlaffnsdvhksfvplfrlpsy
    aegnetltktirqqsaeqileqlafanahlenhiffgeeisvadaylyimlnwcrllgld
    fshlsqlsafmqrveadqgvdnvreqeglkg