PDB entry 4ipy

View 4ipy on RCSB PDB site
Description: HIV capsid C-terminal domain
Class: viral protein
Keywords: viral protein, capsid, core protein
Deposited on 2013-01-10, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ipya_
  • Chain 'B':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ipyb_
  • Chain 'C':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ipyc_
  • Chain 'D':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ipyd_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ipyA (A:)
    msptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilka
    lgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ipyA (A:)
    ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg
    pgatleemmtacqgvggpghkarvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ipyB (B:)
    msptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilka
    lgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ipyB (B:)
    ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg
    pgatleemmtacqgvggpghkarvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ipyC (C:)
    msptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilka
    lgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ipyC (C:)
    ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg
    pgatleemmtacqgvggpghkarvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ipyD (D:)
    msptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilka
    lgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ipyD (D:)
    ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg
    pgatleemmtacqgv