PDB entry 4ipj

View 4ipj on RCSB PDB site
Description: Crystal Structure of R314K N-acetyl Neuraminic Acid Synthase from Neiserria meningitidis with Malate bound
Class: transferase
Keywords: Antifreeze Protein Fold, NANA, N-acetylneuraminic acid, sialic acid, Neisseria meningitidis, TRANSFERASE
Deposited on 2013-01-09, released 2013-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.181
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polysialic acid capsule biosynthesis protein SiaC
    Species: Neisseria meningitidis [TaxId:487]
    Gene: siaC, NMB0068
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7DDU0 (2-350)
      • expression tag (0-1)
      • engineered mutation (315)
    Domains in SCOPe 2.08: d4ipja1, d4ipja2, d4ipja3
  • Heterogens: MN, LMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ipjA (A:)
gamqnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthi
vedemsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaal
rlqrmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpya
llhctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhft
drmdrpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkd
ikkgellsgdnlwvkkpgngdfsvneyetlfgkvaacnirkgaqikktdie