PDB entry 4ipc

View 4ipc on RCSB PDB site
Description: Structure of the N-terminal domain of RPA70, E7R mutant
Class: protein binding
Keywords: OB-fold, PROTEIN BINDING
Deposited on 2013-01-09, released 2013-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: 0.147
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication protein A 70 kDa DNA-binding subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RPA1, REPA1, RPA70
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27694 (3-122)
      • expression tag (0-2)
      • engineered mutation (9)
    Domains in SCOPe 2.08: d4ipca1, d4ipca2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ipcA (A:)
gshmvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfm
latqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvp
yne