PDB entry 4ip3

View 4ip3 on RCSB PDB site
Description: Complex structure of OspI and Ubc13
Class: UNKNOWN FUNCTION/Ligase
Keywords: Papain fold, UNKNOWN FUNCTION-Ligase complex
Deposited on 2013-01-09, released 2013-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ORF169b
    Species: Shigella flexneri [TaxId:623]
    Gene: CP0209, ORF169b, OspI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VSD5 (Start-213)
      • engineered mutation (63)
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, Ubc13, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ip3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ip3B (B:)
    mgsshhhhhhssglvprgshmaglprriiketqrllaepvpgikaepdesnaryfhvvia
    gpqdspfeggtfklelflpeeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalq
    irtvllsiqallsapnpddplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ip3B (B:)
    aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
    ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
    andvaeqwktneaqaietarawtrlyamnni