PDB entry 4ios

View 4ios on RCSB PDB site
Description: Structure of phage TP901-1 RBP (ORF49) in complex with nanobody 11.
Class: viral protein
Keywords: all beta, jelly roll motif, receptor binding protein, neutralizing llama antibody domain, CELL ADHESION-IMMUNE SYSTEM complex, VIRAL PROTEIN
Deposited on 2013-01-08, released 2013-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4iosa_
  • Chain 'B':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4iosb_
  • Chain 'C':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4iosc_
  • Chain 'D':
    Compound: Llama nanobody 11
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IOS
    Domains in SCOPe 2.06: d4iosd_
  • Chain 'E':
    Compound: Llama nanobody 11
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IOS
    Domains in SCOPe 2.06: d4iose_
  • Chain 'F':
    Compound: Llama nanobody 11
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IOS
    Domains in SCOPe 2.06: d4iosf_
  • Chain 'G':
    Compound: Llama nanobody 11
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IOS
    Domains in SCOPe 2.06: d4iosg_
  • Chain 'H':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4iosh_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4iosA (A:)
    tkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvg
    hmvggwnafhidipssgvcqwfgptassgtprgtgtypid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iosB (B:)
    tkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvg
    hmvggwnafhidipssgvcqwfgptassgtprgtgtypid
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iosB (B:)
    kswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvgh
    mvggwnafhidipssgvcqwfgptassgtprgtgtypid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iosC (C:)
    tkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvg
    hmvggwnafhidipssgvcqwfgptassgtprgtgtypid
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iosC (C:)
    kswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvgh
    mvggwnafhidipssgvcqwfgptassgtprgtgtypid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4iosD (D:)
    qvqlvesggglvqagdslrlscavsgrtfssnvigwfrqapgkerefvaaiswstgstyy
    grsmkgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iosD (D:)
    vqlvesggglvqagdslrlscavssnvigwfrqapgkerefvaaiswstgstyygrsmkg
    rcaasrdntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvtvs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4iosE (E:)
    qvqlvesggglvqagdslrlscavsgrtfssnvigwfrqapgkerefvaaiswstgstyy
    grsmkgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iosE (E:)
    vqlvesggglvqagdslrlscavsgrsnvigwfrqapgkerefvaaiswstgstyygrsm
    kgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvtvs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4iosF (F:)
    qvqlvesggglvqagdslrlscavsgrtfssnvigwfrqapgkerefvaaiswstgstyy
    grsmkgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iosF (F:)
    vqlvesggglvqagdslrlscavsgsnvigwfrqapgkerefvaaiswstgstyygrsmk
    grcaasrdkntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvtvs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4iosG (G:)
    qvqlvesggglvqagdslrlscavsgrtfssnvigwfrqapgkerefvaaiswstgstyy
    grsmkgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iosG (G:)
    vqlvesggglvqagdslrlscavsgrsnvigwfrqapgkerefvaaiswstgstyygrsm
    kgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvtv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4iosH (H:)
    tkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvg
    hmvggwnafhidipssgvcqwfgptassgtprgtgtypid