PDB entry 4iom

View 4iom on RCSB PDB site
Description: N10-formyltetrahydrofolate synthetase from Moorella thermoacetica with folate
Class: ligase
Keywords: alpha/beta, enzyme, LIGASE
Deposited on 2013-01-08, released 2013-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.221
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formate--tetrahydrofolate ligase
    Species: Moorella thermoacetica [TaxId:264732]
    Gene: fhs, Moth_0109
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ioma_
  • Chain 'B':
    Compound: Formate--tetrahydrofolate ligase
    Species: Moorella thermoacetica [TaxId:264732]
    Gene: fhs, Moth_0109
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iomb_
  • Heterogens: SO4, TOE, FOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iomA (A:)
    mskvpsdieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgkli
    lvtaitptpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvv
    pmedinlhftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlndralrni
    viglggkangvpretgfdisvasevmaclclasdlmdlkerfsrivvgytydgkpvtagd
    leaqgsmallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvt
    eagfgadlgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregf
    anlekhienigkfgvpavvainafptdteaelnllyelcakagaevalsevwakggeggl
    elarkvlqtlesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryesl
    gygnlpvvmaktqysfsddmtklgrprnftitvrevrlsagagfivpitgaimtmpglpk
    rpaacnididadgvitglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iomA (A:)
    kvpsdieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgklilv
    taitptpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvvpm
    edinlhftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlndralrnivi
    glggkangvpretgfdisvasevmaclclasdlmdlkerfsrivvgytydgkpvtagdle
    aqgsmallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvtea
    gfgadlgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregfan
    lekhienigkfgvpavvainafptdteaelnllyelcakagaevalsevwakggegglel
    arkvlqtlesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryeslgy
    gnlpvvmaktqysfsddmtklgrprnftitvrevrlsagagfivpitgaimtmpglpkrp
    aacnididadgvitglf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iomB (B:)
    mskvpsdieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgkli
    lvtaitptpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvv
    pmedinlhftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlndralrni
    viglggkangvpretgfdisvasevmaclclasdlmdlkerfsrivvgytydgkpvtagd
    leaqgsmallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvt
    eagfgadlgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregf
    anlekhienigkfgvpavvainafptdteaelnllyelcakagaevalsevwakggeggl
    elarkvlqtlesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryesl
    gygnlpvvmaktqysfsddmtklgrprnftitvrevrlsagagfivpitgaimtmpglpk
    rpaacnididadgvitglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iomB (B:)
    kvpsdieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgklilv
    taitptpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvvpm
    edinlhftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlndralrnivi
    glggkangvpretgfdisvasevmaclclasdlmdlkerfsrivvgytydgkpvtagdle
    aqgsmallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvtea
    gfgadlgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregfan
    lekhienigkfgvpavvainafptdteaelnllyelcakagaevalsevwakggegglel
    arkvlqtlesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryeslgy
    gnlpvvmaktqysfsddmtklgrprnftitvrevrlsagagfivpitgaimtmpglpkrp
    aacnididadgvitglf